Abstract
The SARS-CoV-2 virus is more transmissible than previous coronaviruses and causes a more serious illness than influenza. The SARS-CoV-2 receptor binding domain (RBD) of the spike protein binds to the human angiotensin-converting enzyme 2 (ACE2) receptor as a prelude to viral entry into the cell. Using a naive llama single-domain antibody library and PCR-based maturation, we have produced two closely related nanobodies, H11-D4 and H11-H4, that bind RBD (KD of 39 and 12 nM, respectively) and block its interaction with ACE2. Single-particle cryo-EM revealed that both nanobodies bind to all three RBDs in the spike trimer. Crystal structures of each nanobody–RBD complex revealed how both nanobodies recognize the same epitope, which partly overlaps with the ACE2 binding surface, explaining the blocking of the RBD–ACE2 interaction. Nanobody-Fc fusions showed neutralizing activity against SARS-CoV-2 (4–6 nM for H11-H4, 18 nM for H11-D4) and additive neutralization with the SARS-CoV-1/2 antibody CR3022.
Similar content being viewed by others
Main
The SARS-CoV-2 virus is thought, based on sequence identity, to have crossed from bats to humans in 20191. Similar to SARS-CoV-1 (2002–2003) and MERS-CoV (2012), SARS-CoV-2 presents as a respiratory disease but can progress into internal organs and cause organ failure2,3. A recent report from France estimates a fatality rate of 0.7% and a hospitalization rate of 3.6%4. Both these rates are much higher in elderly populations4,5. Around 33% of those admitted to UK hospitals with COVID-19 have died6. Because SARS-CoV-2 also spreads rapidly in the naive human population7, the current COVID-19 pandemic has presented an unprecedented challenge to modern human society. Although there is currently no ‘cure’ or vaccine for the disease, passive immune therapy by transfusing critically ill COVID-19 patients with serum from COVID-19 convalescent individuals has been shown to improve clinical outcomes8,9. This would suggest that neutralization of the virus, even at a relatively late stage in the disease, may be a useful COVID-19 therapy.
The single-positive-strand RNA genome of SARS-CoV-2, like SARS-CoV, encodes four major structural proteins: spike, envelope, membrane and nucleocapsid. The spike protein comprises an N-terminal (S1) subunit, which contains the roughly 200-residue receptor binding domain (RBD)10,11, and a C-terminal subunit (S2), which contains the fusion protein12 (Fig. 1a). The RBD of SARS-CoV-2 binds more tightly to the extracellular domain of angiotensin-converting enzyme 2 (ACE2) (Fig. 1a) than the homologous SARS-CoV-1 RBD13. The higher affinity results from sequence changes in RBD (Fig. 1b) and this has been proposed to underlie the higher transmissibility of SARS-CoV-214. Antibodies raised to the spike protein of SARS-CoV-1 can neutralize the virus both in vitro and in vivo, by binding to the RBD and blocking binding to ACE215. Unfortunately, most of these antibodies do not cross-react with the SARS-CoV-2 RBD13. The CR3022 antibody derived from a convalescent SARS-CoV-1 patient is cross-reactive to both SARS-CoV-1 and SARS-CoV-2 RBD (reported apparent KD of 6 nM, ref. 16). Two studies have reported crystal structures of CR3022 bound to SARS-CoV-2 RBD and show that the target epitope is distant from the ACE2 binding region17,18, which is consistent with the observation that CR3022 does not block RBD binding to ACE2. Another study on CR3022 has reported highly effective SARS-CoV-2 neutralizing activity that appears to arise from destabilization of the spike trimer, a novel mechanism for neutralizing SARS-CoV-218. Destabilization of viral proteins by antibodies has been observed for influenza19 and human immunodeficiency virus20.
Mammalian, including human, antibodies generally have two chains (heavy and light), but camelids, in addition to two-chain antibodies, also possess a single-heavy-chain antibody variant21. The antigen-specific variable portion of this single-chain antibody is termed the VHH domain and is commonly referred to as a nanobody (Fig. 1c). In addition to compatibility with phage display, nanobodies are small, stable and straightforward to produce21. As a result, they serve as alternates to conventional antibodies as diagnostics, imaging agents and structural biology tools21. The direct application of nanobodies in oncology and inflammatory diseases is being evaluated21,22, with caplacizumab23 approved for use. Nanobodies have been developed against SARS-CoV-1 and are currently being developed against SARS-CoV-224,25, both as research tools and potential therapeutics.
Here, we report the identification and characterization of two high-affinity nanobodies (H11-D4 and H11-H4) to the spike protein of SARS-CoV-2 that block the attachment of spike to ACE2 in vitro. Structural characterization of both nanobodies in complex with both full-length spike or with the RBD from SARS-CoV-2 has revealed that both target an epitope immediately adjacent to and slightly overlapping with the ACE2 binding region. Both nanobodies, when fused to immunoglobulin-G (IgG) Fc, neutralized live virus, with H11-H4-Fc showing a particularly high potency (50% neutralization dose (ND50) of 4–6 nM). H11-H4 also showed additive neutralization with CR302216. The nanobodies may have application on their own or in additive combinations with other antibodies in the treatment of severely ill COVID-19 patients.
Results
Identification of a spike-binding nanobody
We used purified RBD of the SARS-CoV-2 spike to identify its binding partners in a naive llama VHH library by in vitro phage display technology. We identified several nanobodies that bound to the RBD. The tightest binding nanobody, which we denoted H11, had a KD of <1 μM (Extended Data Fig. 1a,b). Using a random mutagenesis approach, we identified two affinity matured mutants, H11-D4 and H11-H4, which differ from H11 and each other at five residues within CDR3 (Figs. 1c and 2a). H11-H4 and H11-D4 were shown to bind RBD by surface plasmon resonance (SPR), with an estimated KD of 5 nM and 10 nM, respectively (Fig. 2b and Extended Data Fig. 1c,d). We performed an SPR-based competition assay in which ACE2-Fc was immobilized and then binding of RBD was monitored in the presence or absence of H11-H4 or H11-D4. In a similar experiment, we also monitored spike binding (instead of RBD). Both nanobodies inhibited the binding of both RBD and spike to ACE2 (Fig. 2c and Extended Data Fig. 1e). This suggested the nanobody epitope overlaps with the ACE2 binding site on the RBD of spike. When CR3022-Fc was immobilized and the binding of RBD measured, it was found that the RBD binds to CR3022, whether H11-H4 or H11-D4 was present or not (Fig. 2d and Extended Data Fig. 1f). This indicated that CR3022 and the nanobodies recognized non-overlapping epitopes on RBD. Repeating this experiment with spike also showed binding in the presence and absence of H11-H4 (Fig. 2d and Extended Data Fig. 1f).
The stoichiometry and thermodynamics of binding were characterized by isothermal titration calorimetry (ITC). H11-H4 binds to RBD with a KD of 12 ± 1.5 nM, while H11-D4 binds with a KD of 39 ± 2 nM; both showed a 1:1 stoichiometry (Fig. 2e and Extended Data Fig. 2a). When full-length trimeric spike was used, a single binding event was observed with a 1:1 nanobody:monomer (3:1 nanobody:spike) stoichiometry and a KD of 44 ± 3 nM for H11-H4 and 79 ± 2 nM for H11-D4 (Fig. 2f and Extended Data Fig. 2b). Despite increased enthalpy, H11-D4 bound more weakly than H11-H4 as a result of an increased entropic penalty upon binding. The same enthalpy entropy compensation is observed when comparing spike to RBD for both nanobodies. The spike protein has been proposed to exist in multiple conformational states in solution26, yet ITC showed a simple binding curve (Fig. 2f). Either the nanobodies have bound equally well to all conformational states present or the equilibration between these states was faster than the binding event. The latter possibility seems less likely given the very high on rates (Fig. 2b).
A bivalent Fc-nanobody fusion competes with ACE2 for RBD binding
The nanobodies were fused to the Fc domain of human IgG1 to produce a homodimeric chimeric protein capable of bivalent binding (Fig. 3a). The ability of these constructs to block ACE2 binding to RBD was tested in two assays.
In the first assay, MDCK-SIAT1 cells stably expressing human ACE2 (MDCK-ACE2) were seeded on plates and the ability of various analytes (H11-H4-Fc, H11-D4-Fc, ACE2-Fc, CR302218 and VHH72-Fc) to block binding of RBD was measured (Fig. 3b). VHH7225 is a nanobody isolated from a llama immunized with spike from SARS-CoV-1, which is cross-reactive against spike from SARS-CoV-2. The MDCK- ACE2 cell binding assay yielded a half-maximum inhibitory concentration (IC50) of 61 nM for H11-H4-Fc, 161 nM for H11-D4-Fc and 262 nM for VHH72-Fc25.
In the second competition assay, analytes (H11-H4-Fc, H11-D4-Fc, ACE2-Fc, CR302218, VHH72-Fc25) were assessed for their ability to block ACE2 binding to MDCK cells that expressed RBD on their surface (Fig. 3c). This assay yielded an IC50 of 34 nM for H11-H4-Fc, 28 nM H11-D4-Fc and 33 nM for VHH72-Fc25. As expected, CR3022 does not show a strong response in either assay because it does not block the RBD–ACE2 interaction17,18.
H11-H4-Fc and H11-D4-Fc neutralize virus
The chimeric fusions were tested in a plaque reduction neutralization test at the Public Health England Laboratory for SARS-CoV-2 virus, and showed an ND50 of 6 nM for H11-H4-Fc (95% CI 3–9 nM) and ND50 of 18 nM for H11-D4-Fc (95% CI 9–68 nM) (Fig. 3d and Extended Data Fig. 3). H11-H4-Fc neutralization was replicated at Oxford University and yielded an ND50 of 4 nM. CR3022 was used as a positive control, and under these conditions an ND50 of 93 nM was observed, similar to a previous report18 (Fig. 3e). The raw plates are shown in Extended Data Fig. 4 and we observed a small plaque phenotype in the presence of H11-H4-Fc but not in the positive control CR3022. A small plaque phenotype was noted in the PHE plates (Extended Data Fig. 3).
It should be noted that our assay method did not remove virus and neutralizing agent after incubation with cells, in line with UK standards. Some laboratories have reported a neutralization assay protocol where virus and neutralizing agent are removed during the assay, and precise protocol differences may be responsible for the reported difference in CR3022 neutralization17,18.
Structures of nanobody–spike and nanobody–RBD complexes
The nanobodies were each incubated at room temperature with a purified prefusion-stabilized ectodomain of the SARS-CoV-2 spike protein13 (spike(trimer):nanobody = 1:4) and then vitrified on cryo-EM grids. The cryo-EM single-particle structure of this variant of spike has been shown to be trimeric with a predominantly ‘up–down–down’ arrangement of the three RBDs13. After data collection and processing (Table 1 and Extended Data Figs. 5 and 6), the maps clearly identified additional density at all three RBDs in the H11-D4 and H11-H4 complexes (Extended Data Figs. 5 and 6). Improvement in the Coulomb potential maps allowed fitting of the nanobody into the additional density at each RBD in both structures (Table 1, Methods, Fig. 4a and Extended Data Figs. 5, 6 and 7a). The density for the nanobody bound to the ‘up’ RBD is weak, but still clearly discernible, while the density for the nanobodies bound to the ‘down’ RBDs is clearer (Extended Data Figs. 5 and 6). The structures of H11-H4–spike (Fig. 4a) and H11-D4–spike complexes (Extended Data Fig. 7a) are indistinguishable given their resolution (Table 1). We focus our description here on the complex with the higher-affinity nanobody, H11-H4.
The region of the RBD in contact with the nanobody is ordered in the nanobody complex but is disordered in the EM prefusion stabilized holo spike structures (PDB 6VSB, 6VYB and 6VXX)13,26, precluding detailed analysis. However, we noted that in the nanobody–spike complex, the ‘up’ RBD (subunit A) makes contacts with the nanobody that is bound to ‘down’ RBD (subunit C) (Extended Data Fig. 7b)—contacts that are absent in the holo spike. These contacts have resulted in shifts of the RBD domains when compared to the non-complexed form13,26 (Extended Data Fig. 7c). Matching previous reports26, we have seen a mixture of two forms (‘three down’ and ‘one up two down’) on the grids for holo spike protein. In the presence of the nanobody, only the ‘one up two down’ form was observed, indicating that nanobody binding reduced conformational heterogeneity. We suggest the additional interactions are responsible for this observation and for the higher enthalpy and greater entropic penalty observed for nanobody binding to spike when compared to RBD (Fig. 2e,f).
Nanobodies rely on three variable loops, denoted CDR1, CDR2 and CDR3, to form the antigen-binding site (Fig. 1c). To gain insight into the molecular basis of recognition, crystal structures of the H11-H4–SARS-CoV-2 RBD complex and the H11-D4–SARS-CoV-2 RBD complex were determined to resolutions of 1.85 and 1.80 Å, respectively (Table 2). Both crystal structures have a single copy of the complex in the asymmetric unit. Superposition of the two complexes has confirmed that both nanobodies recognize the same epitope (Fig. 4b). Comparison of the structures shows that the entire complex superimposes with a root-mean-square deviation (r.m.s.d.) of 1.0 Å over 322 Cα atoms, but the individual RBDs superimpose with an r.m.s.d. of 0.5 Å over 195 Cα atoms and the individual nanobodies with an r.m.s.d. of 0.4 Å over 127 Cα atoms. The higher r.m.s.d. for the complex arises from a 7° pivot motion of the nanobodies with respect to each other (Fig. 4c). Given the very high degree of similarity between the complexes, we again focused the description on the H11-H4–RBD complex (Fig. 4d). There are differences compared to the H1-D4–RBD complex, due to sequence changes in the CDR3 loops, and a detailed description of the H1-D4–RBD interface is provided in Supplementary Figs. 1 and 2 and Supplementary Note 1.
In the complex, the CDR1 loop of H11-H4 has contributed very little to the interface (Fig. 4e). From CDR2, residues Arg52, Ser54 and Ser57 have made contacts with RBD (Fig. 4d,e). From CDR3, His100 to Leu106, the region modified during maturation, made contacts with RBD (Fig. 4d,e). The surface on RBD that contacts H11-H4 is formed by Lys444 to Phe456 and Gly482 to Ser494 (Fig. 4f). These two stretches of RBD sequence comprise 90% of the buried surface area and make all the hydrogen bonds with H11-H4 (Fig. 4g). In addition to these direct contacts, there are multiple bridging water molecules. To our surprise, the PISA server27 does not identify either nanobody–RBD complex as stable.
Arg52 from the CDR2 of H11-H4 was found at the heart of a network of interactions, including RBD residues Glu484, with which it made a bivalent salt link, and Phe490, with which it made a π–cation interaction28 (Fig. 4h). Arg52 also forms hydrogen bonds to the backbone carbonyl of Ser103 and side chain of Tyr109 (Fig. 4h), which may stabilize the conformation of the CDR3 loop. The seven-residue stretch of the H11-H4 CDR3 region, which varied during maturation, contributes over 60% of the surface area buried by the complex and makes five hydrogen bonds to RBD (Fig. 4g).
Using the H11-D4–RBD complex, we created a model of three nanobodies bound to the ‘down’ (closed) form of the spike26 (Extended Data Fig. 7d). This model does not disclose any clashes, suggesting that the nanobody would bind to the spike protein in all its conformational states, consistent with the simple ITC curve (Fig. 2e).
The nanobody epitope compared to other RBD binders
Superposition of the RBD–ACE2 complex29,30 on the H11-H4–RBD complex reveals that H11-H4 would, consistent with biophysics (Fig. 2c), plate assays (Fig. 3b,c) and neutralization experiments (Fig. 3d), prevent ACE2 binding to RBD (Fig. 5a). This is due to van der Waals clashes, principally between regions of H11-H4 that are not in contact with the RBD and regions of ACE2 (also not in contact with RBD; Fig. 5a). Interestingly the contact surface of H11-H4 on RBD shows only a small overlap with the ACE2 contact surface (Figs. 1b and 5b). Comparison with the RBD–ACE2 complex29,30 reveals that residues 445–500 of RBD appear to move as a rigid unit upon H11-H4 binding (Extended Data Fig. 8a). The structure of the loop centered at Val483 of the RBD has changed upon binding of H11-H4 (Extended Data Fig. 8b).
Given the potential for additive and synergistic effects that can arise from combinations of antibodies and/or nanobodies that recognize different epitopes, crystals of ternary complexes H11-H4–RBD–CR3022 (3.3 Å) and H11-D4–RBD–CR3022 (2.7 Å) were obtained (Table 2). The structures are similar, and we focus on the higher-resolution H11-D4–RBD–CR3022 complex. As expected, the nanobody and the antibody bind to non-overlapping epitopes (Fig. 5c). Furthermore, comparison of H11-D4–RBD–CR3022 ternary complex with both the H11-D4–RBD complex and RBD–CR3022 complex17,18 showed that binding of the nanobody does not perturb the recognition of the antibody and vice versa. This is consistent with biophysical analysis that shows CR3022 binds to RBD and to the nanobody–RBD complex equally well (Fig. 2d and Extended Data Fig. 1f).
Discussion
It is assumed that, during the virus life cycle, the spike trimer exists in an equilibrium between the all ‘down’ configuration and mixed ‘up down’ states13. The spike protein can only bind to ACE2 with the RBD in the ‘up’ state11 and this results in dissociation of the trimer. SARS-CoV-2 spike binds to ACE2 with a 10- to 20-fold higher affinity (KD of ~15 nM) than SARS-CoV-1 spike, a fact that has been proposed to drive its higher transmissibility13,31. Neutralizing antibodies that have been identified so far for SARS-CoV-1 bind to the RBD of the spike protein and many do so by blocking ACE2 binding32, but CR3022 operates by a different mechanism18. We have identified two nanobodies, H11-H4 and H11-D4, which differ in sequence at five residues within the CDR3 loop (Fig. 2a) and have shown some subtle differences in properties (Figs. 2 and 3). Given that the H11-H4 nanobody has the higher affinity for RBD (Fig. 2e,f), the discussion focuses on this variant, but, unless explicitly stated, is equally valid for H11-D4.
We have shown that H11-H4 binds with high affinity to RBD (Fig. 2b,e,f), blocks ACE2 binding (Figs. 2c and 3b,c) and neutralize the virus (Fig. 3d,e). Our analysis has suggested that H11-H4 would bind to both the ‘all down’ as well as ‘two down one up’ conformations of RBD within the spike (Fig. 4a and Extended Data Fig. 7c). The epitope on SARS-CoV-2 RBD that is recognized by H11-H4 overlaps only to a limited degree with the ACE2 binding region (Fig. 5a,b). This region of SARS-CoV-2 RBD has several sequence changes when compared to SARS-CoV-1 RBD (Fig. 1b). The Pro469–Pro470 turn in the SARS-CoV-1 RBD structure33 is very different to the structure at Val483–Glu484 in SARS-CoV-2. Additional sequence and structural changes between SARS-CoV-1 and SARS-CoV-2 (Tyr442→Leu455, Trp476→Phe490, Asn479→Gln493) combine to present a very different epitope and would seem to preclude cross-reactivity of H11-H4. The lack of conservation of the H11-H4 epitope between SARS-CoV-1 and SARS-CoV-2 raises the possibility that SARS-CoV-2 variants may emerge that retain ACE2 receptor binding but are no longer recognized by H11-H4 or its relatives. At least some of the plausible escape mutations would perturb the position of Phe486, which inserts into a cleft in ACE2, an interaction important to the increased affinity of SARS-CoV-230. The rapid pipeline from naive library screen to maturation and thorough characterization does offer the possibility that new nanobodies could be generated against SARS-CoV-2 viruses that have escaped H11-H4.
The characterization of the cross-reactive (SARS-CoV-1, KD = 7 nM and SARS-CoV-2, KD = 40 nM) nanobody VHH72 has been reported recently25. This nanobody blocks ACE2 binding and shows neutralization activity (ND50 = 0.2 μg ml−1) against the SARS-CoV-2 pseudovirus25. The crystal structure of the complex between VHH72 and RBD from SARS-CoV25 showed that VHH72 recognizes an epitope that is different from that bound by H11-H4 (Extended Data Fig. 9a). The epitope bound by VHH72 partly overlaps with the epitope bound by CR302218 (Extended Data Fig. 9b) and is found in a crystal contact between H11-H4 and RBD in the complex (Extended Data Fig. 9c,d). Another antibody, which, like CR3022, does not block ACE2 binding but neutralizes the virus, has also been published34, but there are no further structural details. Humanized nanobodies with potent neutralization activity against SARS-CoV-2 virus (most potent ND50 of 17–36 nM in Vero cells) have been described35. Some, but not all, of these nanobodies blocked ACE2 binding and no molecular insights into their mode of action were reported35. A preprint has reported a llama antibody, Ty1, that neutralizes pseudovirus and blocks ACE2 binding36, but the coordinates of the EM structure are not available.
The use of convalescent serum has shown clinical promise in patients severely ill with SARS-CoV37 and most recently SARS-CoV-29; such passive immune therapy has a long history in medicine38. The use of laboratory-produced reagents avoids some of the infection risks that arise from use of human serum and can be administered in smaller volumes. The use of antibodies as therapies is well established but nanobodies have now entered clinical trials21, with one, caplacizumab23, now licensed. The direct injection of a nanobody has also shown promise in a mouse model of cobra venom intoxication39. Camelid VHH domains are highly conserved with their human counterparts, and their immunogenicity has been proposed to be low40, although humanization strategies are well developed41.
To increase the in vivo half-life and enhance avidity, nanobodies can be multimerized by a variety of means22. For our in vitro binding assays (Fig. 3b,c) and neutralization experiments (Fig. 3d,e), we created a dimeric Fc fusion construct (Fig. 3a). Because the CR3022 antibody17,18 recognized a different epitope than H11-H4 (Figs. 2d and 5c), we investigated a combination of H11-H4 and CR3022 (CR3022 concentration fixed at 84 nM). Under these assay conditions, we observed evidence for an additive effect (Fig. 5d). Such additive combinations are a well-known strategy to reduce the propensity of the virus to escape by mutating.
This work establishes that nanobody maturation technology can be deployed to produce a highly neutralizing agent against an emerging viral threat in real time. The approach may be useful in identifying complementary epitopes to those identified by animal immunization approaches. The H11-H4 and H11-D4 nanobodies may find application in a cocktail of laboratory-synthesized neutralizing antibodies given for passive immunization of severely ill COVID-19 patients.
Methods
Protein production
Nanobody sequences (DNA and protein), protein constructs and production are described in full in Supplementary Note 2. All primers used in this work are listed in Supplementary Table 1. Plasmids encoding the nanobodies described here are available at Addgene (www.addgene.org).
Screening of a VHH library to identify molecules that bind to SARS-CoV-2 RBD
A VHH phage display library (Abcore) constructed in the vector pADL-20c and comprising ~1 × 1010 independent clones was inoculated into 2xTYA (2xTY supplemented with 100 μg ml−1 ampicillin) and infected with M13 helper phage to obtain a library of VHH-presenting phages. Phages displaying VHHs specific for the SARS-CoV-2 RBD were enriched after two rounds of biopanning on 50 nM and 5 nM of RBD, respectively, by capturing with Dynabeads M-280 (Thermo Fisher Scientific). For each round of panning, the Dynabeads and phages were first blocked with StartingBlock (PBS) blocking buffer (Thermo Fisher Scientific) for 30 min. The phages were incubated with the RBD for 1 h and then 5 min with the Dynabeads (Thermo Fisher Scientific), and subsequently washed six times with PBS supplemented with 0.05% Tween 20 and once with PBS. The retained phages were eluted through incubation with TBSC buffer (10 mM Tris pH 7.4, 137 mM NaCl, 1 mM CaCl2) and 1 mg ml−1 trypsin (Sigma-Aldrich) for 30 min. The collected phages were amplified in exponentially growing TG1 Escherichia coli cells and plated on 2xTY agar plates supplemented with 100 μg ml−1 ampicillin. Enrichment after each round of panning was determined by plating the cell culture with 10-fold serial dilutions. After the second round of panning, 93 individual clones were picked to inoculate 2xTYA and were grown overnight at 37 °C, while shaking at 250 r.p.m. The next day, the overnight culture was used to inoculate 2xTYA and infected with M13 helper phage to obtain clonal VHH-presenting phages.
Enzyme-linked immunosorbent assays to quantitate initial binding
The wells of microtiter plates (Greiner high and medium binding) were coated with 5 µg ml−1 neutravidin in PBS pH 7.4 overnight at 4 °C. The next day, the wells were coated with 50 nM biotinylated RBD, then blocked with 3% milk powder in PBS pH 7.4. Supernatant of clonal phage was added into each well, binding was detected by incubating the wells with horseradish peroxidase (HRP)-conjugated anti-M13 (GE Healthcare). After washing, 100 μl of TMB substrate (SeraCare) was added and absorbance at 405 nm was measured with a microplate absorbance reader.
Affinity maturation of nanobody H11
Mutations in the CDR3 of nanobody H11 were introduced by PCR using seven pairs of forward and reverse primers as shown in Supplementary Table 1 (H11_AM_CDR3_F1–7 in combination with H11_AM_CDR3_R1–7). The mutated fragments were amplified with primers H11_Phd_F and H11_Phd_R, digested with SfiI restriction enzyme and cloned into pADL-23c phagemid (Antibody Design Laboratories). The ligated vector was transformed into TG1 cells by electroporation to give a phage library consisting of ~2 × 109 independent clones. Two rounds of biopanning of the library were carried out on 5 nM and 1 nM RBD, respectively, as described above, and positive phage was identified by ELISA and sequencing.
Surface plasmon resonance and isothermal titration calorimetry
SPR experiments were performed using a Biacore T200 system (GE Healthcare). All assays were performed using a Sensor Chip Protein A (GE Healthcare), with a running buffer of PBS pH 7.4 supplemented with 0.005% vol/vol surfactant P20 (GE Healthcare) at 25 °C.
To determine the binding affinity of nanobody H11 for the SARS-CoV-2 RBD, RBD-Fc was immobilized onto the sample flow cell of the sensor chip. The reference flow cell was left blank. Nanobody H11 was injected over the two flow cells at a range of eight concentrations prepared by serial twofold dilutions from 2.5 μM, at a flow rate of 30 μl min−1, with an association time of 60 s and a dissociation time of 60 s. The data were fitted to a 1:1 binding model and to calculate KD using GraphPad Prism 8.
To determine the binding kinetics between the SARS-CoV-2 RBD and nanobody H11-H4/H11-D4, RBD-Fc was immobilized onto the sample flow cell of the sensor chip. The reference flow cell was left blank. Nanobody H11-H4/H11-D4 was injected over the two flow cells at a range of five concentrations prepared by serial twofold dilutions from 50 nM, at a flow rate of 30 μl min−1 using a single-cycle kinetics program with an association time of 60 s and a dissociation time of 60 s. Running buffer was also injected using the same program for background subtraction. All data were fitted to a 1:1 binding model using Biacore T200 Evaluation Software 3.1.
In the competition assay where CR3022-Fc or ACE2-Fc was used as the ligand, ~1,000 RU of CR3022-Fc or ACE2-Fc was immobilized. The following samples were injected: (1) a mixture of 1 µM nanobody H11-H4/H11-D4 and 0.1 µM RBD; (2) a mixture of 1 µM E08R (anti-Caspr2 Fab) Fab and 0.1 µM RBD; (3) 0.1 µM RBD; (4) a mixture of 1 µM nanobody H11-H4/H11-D4 and 0.1 µM spike; (5) a mixture of 1 µM E08R Fab and 0.1 µM spike; (6) 0.1 µM spike; (7) 1 µM nanobody H11-H4/H11-D4; (8) 1 µM E08R Fab. All injections were performed with an association time of 60 s and a dissociation time of 600 s. All curves were plotted using GraphPad Prism 8.
ITC measurements were carried out using an iTC200 MicroCalorimeter (GE Healthcare) at 25 °C. Spike, RBD and nanobody were prepared and dialyzed in the same buffer, that is, PBS. Nanobody was titrated into spike or RBD solution corresponding to ~72 μM nanobody and 6 μM spike or 250 μM nanobody and 25 μM RBD. Each experiment consisted of an initial injection of 0.4 μl followed by 16 injections of 2.4 μl of nanobody solution into the cell containing either spike or RBD, while stirring at 750 r.p.m. Data acquisition and analysis were performed using the Origin scientific graphing and analysis software package (OriginLab). Data analysis was performed by generating a binding isotherm and best fit using the following parameters: n (number of sites), ΔH (calories per mole), ΔS (calories per mole per degree) and K (binding constant in mol−1). Following data analysis, K was converted to the dissociation constant (KD, in nM).
ACE2 blocking and neutralization experiments
MDCK-SIAT1 cells were stably transfected with codon-optimized human ACE2 cDNA (NM_021804.1) using a second-generation lentiviral vector system and fluorescent activated cell sorting (FACS) for highly expressing population. Cells (3 × 104 per well) were seeded the day before the assay on a flat-bottomed 96-well plate. RBD-6H (amino acids 340–538; NITN.GPKK) was chemically biotinylated using EZ-link sulfo-NHS-biotin (A39256, Life Technologies). A serial half-log dilution (ranging from 1 μM to 0.1 nM) of analytes and controls was performed in a U-bottomed 96-well plate in a volume of 30 μl. An equal volume of 25 nM biotinylated RBD was added and 50 μl of each of the resulting mixtures were added to the MDCK-ACE2 cells for 1 h. A second layer of streptavidin-HRP (S911, Life Technologies) diluted 1:1,600 in PBS/0.1% BSA (37525, Thermo Fisher Scientific) was then added and incubated for 1 h. Plates were then washed with PBS four times, and the signal was developed by adding POD substrate (11484281001, Roche) for 5 min before stopping with 1 M H2SO4. Plates were read at an optical density at 450 nm (OD450) on a Clariostar plate reader. The control analyte (a non-blocking anti influenza N1 antibody) was used to obtain the maximum signal and PBS-only wells were used to determine background. Graphs were plotted as percent binding of biotinylated RBD to ACE2. Binding % = (X − min)/(max − min) × 100 where X = measurement of the competing component, min = buffer without binder biotinylated RBD-6H, max = biotinylated RBD-6H alone. The IC50 values of the nanobodies against ACE2 were determined using nonlinear regression [inhibitor] versus normalized response curve fit using GraphPad Prism 8.
MDCK-SIAT1 cells were stably transfected with RBD (amino acids 340–538 NITN.GPKK) fused to the transmembrane and cytoplasmic domain of hemagglutinin H7 (A/HongKong/125/2017) (EPI977395) via a short linker for surface expression (sequence TGSGGSGKLSSGYKDVILWFSFGASCFILLAIVMGLVFICVKNGNMRCTICI*) using a second-generation lentiviral vector system. RBD-expressing cells were FACS sorted using the CR3022 antibody. Cells (3 × 104 per well) were seeded the day before the assay on a flat-bottomed 96-well plate. ACE2-Fc was biotinylated as above. A serial half-log dilution (ranging from 1 μM to 0.1 nM) of analytes and controls was performed in a U-bottomed 96-well plate in a volume of 30 μl, then 30 μl of biotinylated Ace2-Fc at 5 nM was added to the titrated analytes. Cells were washed with PBS and 50 μl of each mixture of ACE2 and an analyte was transferred to the cells and incubated for 1 h at room temperature. Cells were then washed with PBS and incubated for 1 h with the second-layer streptavidin-HRP (S911, Life Technologies), diluted to 1:1,600, and developed as above. Graphs were plotted as percent binding of biotinylated ACE2 to RBD. Binding % = (X − min)/(max − min) × 100 where X = measurement of the competing component, min = buffer without binder biotinylated ACE2-Fc, max = biotinylated ACE2-Fc alone. IC50 values of the nanobodies against ACE2 were determined using nonlinear regression [inhibitor] versus normalized response curve fit using GraphPad Prism 8. Non-biotinylated ACE2-Fc-6H and VHH72-Fc were used as positive controls.
Plaque reduction neutralization tests at Public Health England used SARS-CoV-2 (Australia/VIC01/2020)43, which was diluted to a concentration of 933 p.f.u. ml−1 (70 p.f.u./75 μl) and mixed 50:50 in minimal essential medium (MEM; Life Technologies) containing 1% FBS (Life Technologies) and 25 mM HEPES buffer (Sigma) with doubling antibody dilutions in a 96-well V-bottomed plate. The plate was incubated at 37 °C in a humidified box for 1 h to allow neutralization to take place. Afterwards, the virus-antibody mixture was transferred into the wells of a twice Dulbecco’s PBS-washed 24-well plate containing confluent monolayers of Vero E6 cells (ECACC 85020206, PHE) that had been cultured in MEM containing 10% (vol/vol) FBS. Virus was allowed to adsorb onto cells at 37 °C for a further hour in a humidified box, then the cells were overlaid with MEM containing 1.5% carboxymethyl cellulose (Sigma), 4% (vol/vol) FBS and 25 mM HEPES buffer. After five days incubation at 37 °C in a humidified box, the plates were fixed overnight with 20% formalin/PBS (vol/vol), washed with tap water and then stained with 0.2% crystal violet solution (Sigma) and plaques were counted. A mid-point probit analysis (written in R programming language for statistical computing and graphics) was used to determine the dilution of antibody required to reduce SARS-CoV-2 viral plaques by 50% (ND50) compared with the virus-only control (n = 5). The script used in R was based on a previously reported source script44. Antibody dilutions were run in duplicate and an internal positive control for the PRNT assay was also run in duplicate using a sample of heat-inactivated (56 °C for 30 min) human MERS convalescent serum known to neutralize SARS-CoV-2 (National Institute for Biological Standards and Control, UK). The plates are shown in Extended Data Fig. 3c.
Plaque reduction neutralization tests in Oxford were performed using passage 4 of SARS-CoV-2 Victoria/01/202043 using the established methodology45. In brief, virus stock (9.75 × 104 p.f.u. ml−1) was diluted by 10 and by 100 in Dulbecco’s modified Eagle’s medium containing 1% FBS (D1; 100 μl), mixed with nanobody-Fc (100 μl) diluted in D1 so as give a final concentrations of H11-H4 at 100, 32, 10, 3.2 nM for measurement. As a positive control, solutions with CR3022 333, 167, 84 and 42 nM were prepared. Each experiment was performed in triplicate in a 24-well tissue culture plate. The plate was incubated at room temperature for 30 min and 0.5 ml of a single cell suspension of Vero E6 cells in D1 at 5 × 105 ml−1 was added. The plates were incubated for a further 2 h at 37 °C before being overlain with 0.5 ml of D1 supplemented with carboxymethyl cellulose (1.5%). The resulting cultures were incubated for a further four days at 37 °C before plaques were revealed by staining the cell monolayers with Amido Black in acetic acid/methanol (Extended Data Fig. 4a–d). To probe whether CR3022 and H11-H4 were additive, solutions of H11-H4 at 100, 32, 10 and 3.2 nM were each incubated for 30 min with CR3022 at a final concentration of 84 nM. The resulting mixtures were analyzed as described above in triplicate experiments and the wells are shown in Extended Data Fig. 4d.
Cell lines
Oxford neutralization used Vero Ccl-81 (from a stock that was originally from ATCC). PHE neutralization used Vero E6 cells purchased from ECACC. Cell-based competition assays used MDCK-SIAT1 cells derived from a commercial source (Sigma-Aldrich). All mammalian protein expressions were performed with purchased 293Expi cells (Thermo Fisher Scientific) and E. coli cells.
Nanobody complex with spike, preparation and cryo-electron microscopy data collection
Purified spike protein in 10 mM HEPES, pH 8, 150 mM NaCl was incubated with H11-H4 purified in 50 mM Tris, pH 7, 150 mM NaCl, at a molar ratio of 1:3.6 (spike trimer:nanobody) at 16 °C overnight. Spike protein was used at a final concentration of 1 mg ml−1. The mixture was centrifuged at 21,000g at 16 °C before grid preparation. For H11-D4–spike, a mixture in a molar ratio of 1:6 (spike trimer:nanobody) was incubated at 20 °C for 10 min.
A 3 μl volume of the resulting H11-D4–spike sample was then applied to a holey carbon-coated 200 mesh copper grid (C-Flat, CF-2/1, Protochips) that had been freshly glow-discharged on high for 20 s (Plasma Cleaner PDC-002-CE, Harrick Plasma). Excess liquid was removed by blotting for 6 s with a blotting force of −1 using Vitrobot filter paper (grade 595, Ted Pella) at 4.5 °C and 100% relative humidity. Blotted grids were then immediately plunge-frozen using a Vitrobot Mark IV system(Thermo Fisher Scientific).
Frozen grids were first screened on a Glacios microscope operating at 200 kV (Thermo Fisher Scientific) before imaging on a Titan Krios G2 (Thermo Fisher Scientific) at 300 kV. Videos (40 frames each) were collected in compressed tiff format on a K3 detector (Gatan) in super-resolution counting mode using a custom EPU version 2.5 (Thermo Fisher Scientific) (Table 1). Motion correction and alignment of 2× binned super-resolution movies was performed using Relion (v3.1)46 with a 5 × 5 patch-based alignment. Contrast transfer function (CTF) estimation of full-frame non-weighted micrographs was performed using GCTF (v1.06), and non-template-driven particle picking was then performed within cryoSPARC (v2.14.1-live)47 followed by multiple rounds of two-dimensional (2D) classification. The resulting 2D class averages consistent with spike trimer were used for template-driven particle picking before further rounds of 2D and 3D classification with C1 symmetry. The resulting map from the most populous class was then sharpened in cryoSPARC before conversion to Relion-format star files using custom pyEM scripts48 (csparc2star.py, https://github.com/asarnow/pyem) for further CTF refinement within Relion.
An initial model for spike was generated using PDB 6VXX26 and rigid body fitted into the map using Chimera49 followed by Coot50. The H11-D4–RBD crystal structure was superimposed onto the naked spike model in Coot and checked for fit in the density. S1/S2 domains split into subdomains for each subunit (residues 27–307; 308–321 and 591–700; 322–333 and 529–590; 701–1147) were then independently rigid body fitted in Coot50, before a final real-space refinement with PHENIX51, with hydrogen atoms added using ReadySet51, resulting in a final correlation coefficient of 0.8. The H11-D4–RBD crystal structure was used as reference structure restraints during refinement of the spike due to the density. Rounds of manual inspection in Coot50 and real-space refinement with PHENIX51 resulted in the final model. Data processing and refinement statistics are shown in Table 1.
For the H11-H4 spike sample, SPT Labtech prototype 300 mesh 1.2/2.0 nanowire grids with a highly reproducible rectangular bar cross-section were used. The grids were glow-discharged on low for 90 s (plasma cleaner PDC-002-CE, Harrick Plasma) to activate the nanowires. Approximately 6 nl of the complex were applied to the grids using a Chameleon EP system (SPT Labtech) at 81% relative humidity and ambient temperature.
Frozen grids were screened and then data collected using a Titan Krios G2 system (Thermo Fisher Scientific) equipped with a Bioquatum-K3 detector (Gatan) operated at 300 kV. Videos (50 frames each) were collected in compressed tiff format in super-resolution counting mode using a custom EPU version 2.5 (Thermo Fisher Scientific).
Processing of videos up to 2D classification was done automatically using the Relion_IT.py processing pipeline implemented at eBIC. In detail, motion correction and alignment of 2× binned super-resolution movies were performed using Relion (v3.08)46 with a 5 × 5 patch-based alignment. CTF estimation of full-frame non-weighted micrographs was performed using GCTF (v1.06) and non-template-driven particle picking was then performed within crYOLO52 followed by 2D classification. The best 2D classes clearly showing details consistent with the spike complex were selected for further processing. 3D classification was performed using emd_21374 low-pass-filtered to 60 Å. Initially the data were processed as C3 but relaxed to C1 as the RBD and nanobody densities were poor. The best C1 3D class was selected for further refinement, CTF refinement and particle polishing within Relion.
The coordinates from the spike–H11-D4 structure were rigid-body-docked into the spike–H11-H4 cryo-EM density in Chimera49 and then refined with multiple rounds of jelly body refinement using RefMac5 via CCP-EM GUI53,54, and manual intervention with Coot resulted in a final correlation coefficient of 0.78. Due to the limited resolution of the nanobody density in the cryo-EM map, the refined nanobody structure was replaced by the docked H11-H4–RBD crystal structure in the final model. Finally, the nanobodies were docked as rigid bodies into the cryo-EM density using Chimera49 to optimize their position. Data processing and refinement statistics are shown in Table 1.
H11-D4–RBD–CR3022 and H11-H4–RBD–CR3022 crystallography
Purified RBD, Fab CR3022 and H11-D4 were mixed together at a molar ratio of 1:1:1 to a final concentration of ~7 mg ml−1 and incubated at room temperature for 1 h. Initial screening was performed in 96-well plates using the nanoliter sitting-drop vapor diffusion method. The best crystals were grown in conditions containing 0.1 M sodium citrate tribasic dihydrate, pH 5.0 and 10% (wt/vol) polyethylene glycol (PEG) 6000.
Purified RBD, Fab CR3022 and nanobody H11-H4 were mixed together at a molar ratio of 1:1:1.1, incubated at room temperature for 1 h and run on a gel filtration column. Initial screening was performed in 96-well plates using the nanoliter sitting-drop vapor diffusion method. The best crystals were grown by mixing 0.1 μl of the 20 mg ml−1 H11-H4–RBD–CR3022 complex with 0.1 μl of the crystallization buffer as above. Crystals were soaked in cryoprotectant containing 70–75% reservoir solution and 20–25% glycerol for a few seconds, then mounted in loops and frozen in liquid nitrogen before data collection at beamline I03 of Diamond Light Source, UK.
Two crystal forms for H11-D4–RBD–CR3022 were obtained (Table 2). For the first form collected, three crystals, 360° each, were merged to give a final dataset to 3.3-Å resolution with 78-fold redundancy. A second form appeared later and yielded 2.7 Å from a single crystal, although the data were anisotropic. A single crystal of H11-H4–RBD–CR3022 was collected.
Data were indexed, integrated and scaled with the automated data-processing program Xia2-dials55,56. The crystal structure of the first crystal of the H1-D4–RBD–CR3022 complex was solved by molecular replacement using the known RBD–CR3022 structure (PDB 6YLA18) and the known structure of the nanobody 9G8 (PDB 4KRP57). The high-resolution structures of the H11-D4–RBD and H11-H4–RBD complexes then became available and were used in subsequent solutions. The electron density H11-H4–RBD–CR3022 was, as seen in the low-resolution H11-D4–RBD–CR3022 structure, poor for the nanobody—a reflection of the relatively low resolution of the study.
Model rebuilding was done with Coot50, initially refined with PHENIX51 then with REFMAC558 aided by PDB-REDO59, MOLPROBITY60 and the TLSMD server61.
H11-H4–RBD and H11-D4–RBD crystallography
Each nanobody was mixed with 8.7 mg of RBD at 2.9 mg ml−1 at a molar ratio of nanobody:RBD of 1.1:1 and the complex was incubated for 3 h in a cold room under agitation at 2 r.p.m. RBD in the complex was deglycosylated by the addition of 0.4 mg of EndoH glycosidase and incubated overnight at room temperature, under agitation at 2 r.p.m. The mixture was then concentrated to 1 ml with a 5-kDa molecular weight cutoff (MWCO) concentrator and injected for gel filtration using a Superdex 200 10/300 system (GE) in 50 mM Tris pH 7, 150 mM NaCl. The peak fractions were pooled and concentrated using a 5-kDa MWCO concentrator to 10 mg ml−1, 18 mg ml−1 and 29 mg ml−1.
Crystallization screening was performed on the Diamond/RCaH/RFI HTP crystallization facility at Harwell. Crystals of H11-D4–RBD were grown at 20 °C using the sitting-drop vapor diffusion method by mixing 0.2 μl of the 18 mg ml−1 complex with 0.1 μl of the crystallization buffer containing 0.2 M sodium acetate trihydrate, 0.1 M MES pH 6.0, 20% wt/vol PEG 8000. H11-D4–RBD crystals grew overnight and were flash-cooled in a solution containing the mother liquor with 30% (vol/vol) ethylene glycol. Crystals of H11-H4–RBD were grown at 20 °C using the sitting-drop vapor diffusion method by mixing 18 mg ml−1 of complex with 0.1 μl of the crystallization buffer containing 0.2 M lithium sulfate, 0.1 M Bis Tris pH 5.5 and 25% wt/vol PEG 3350. H11-H4–RBD crystals grew overnight and were flash-cooled in a solution containing the mother liquor with 30% (vol/vol) PEG 400. Diffraction data were also collected and processed at beamline I03 at Diamond Light Source. The H11-D–RBD structure was solved by molecular replacement62 using the RBD and H11-D4 monomers from the ternary complex above. Refinement was carried out as described above for the ternary complex. The H11-H4–RBD complex was solved using the H11-D4–RBD complex. Statistics for X-ray data collection and structure refinement are provided in Table 2. Electron densities for both complexes are shown in Extended Data Fig. 8c,d.
Reporting Summary
Further information on research design is available in the Nature Research Reporting Summary linked to this Article.
Data availability
The coordinates and structure factors were deposited in the wwPDB with accession nos. PDB 6ZH9 (H11-H4–RBD–CR3022), 6ZBP (H11-H4–RBD), 6YZ7 and 6Z2M (H11-D4–RBD–CR3022) and 6YZ5 (H11-D4–RBD). EM maps and models are deposited in the EMDB and wwPDB under accession codes EMD-11218 and PDB 6ZHD (prefusion spike with H11-H4); EMD-11068 and PDB 6Z43 (prefusion spike with H11-D4). The underlying biophysical data and raw images for neutralization are provided in the Extended Data. Nanobody sequences are provided in Supplementary Note 2.
Change history
03 February 2021
A Correction to this paper has been published: https://doi.org/10.1038/s41594-021-00566-w
References
Menachery, V. D. et al. A SARS-like cluster of circulating bat coronaviruses shows potential for human emergence. Nat. Med. 21, 1508–1513 (2015).
Ronco, C., Reis, T. & Husain-Syed, F. Management of acute kidney injury in patients with COVID-19. Lancet Resp. Med. 8, 738–742 (2020).
Jaiswal, N. K. & Saxena, S. K. in Medical Virology: From Pathogenesis to Disease Control: Coronavirus Disease 2019 (COVID-19) 141–150 (Springer, 2020).
Salje, H. et al. Estimating the burden of SARS-CoV-2 in France. Science https://doi.org/10.1126/science.abc3517 (2020); erratum https://doi.org/10.1126/science.abd4246
Adams, M. L., Katz, D. L. & Grandpre, J. Population-based estimates of chronic conditions affecting risk for complications from Coronavirus Disease, United States. Emerg. Infect. Dis. https://doi.org/10.3201/eid2608.200679 (2020).
Docherty, A. B. et al. Features of 20 133 UK patients in hospital with covid-19 using the ISARIC WHO Clinical Characterisation Protocol: prospective observational cohort study. BMJ 369, m1985 (2020).
Kucharski, A. J. et al. Early dynamics of transmission and control of COVID-19: a mathematical modelling study. Lancet Infect. Dis. 20, 553–558 (2020).
Bloch, E. M. et al. Deployment of convalescent plasma for the prevention and treatment of COVID-19. J. Clin. Invest. 130, 2757–2765 (2020).
Shen, C. et al. Treatment of 5 critically ill patients with COVID-19 with convalescent plasma. JAMA 323, 1582–1589 (2020).
Wan, Y., Shang, J., Graham, R., Baric, R. S. & Li, F. Receptor recognition by the novel coronavirus from Wuhan: an analysis based on decade-long structural studies of SARS coronavirus. J. Virol. 94, e00127-20 (2020).
Yan, R. et al. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science 367, 1444–1448 (2020).
Li, F. Structure, function and evolution of coronavirus spike proteins. Annu. Rev. Virol. 3, 237–261 (2016).
Wrapp, D. et al. Cryo-EM structure of the 2019-nCoV spike in the prefusion conformation. Science 367, 1260–1263 (2020).
Hoffmann, M. et al. SARS-CoV-2 cell entry depends on ACE2 and TMPRSS2 and is blocked by a clinically proven protease inhibitor. Cell 181, 271–280 (2020).
Zhu, Z. et al. Potent cross-reactive neutralization of SARS coronavirus isolates by human monoclonal antibodies. Proc. Natl Acad. Sci. USA 104, 12123–12128 (2007).
Tian, X. et al. Potent binding of 2019 novel coronavirus spike protein by a SARS coronavirus-specific human monoclonal antibody. Emerg. Microbes Infect. 9, 382–385 (2020).
Yuan, M. et al. A highly conserved cryptic epitope in the receptor-binding domains of SARS-CoV-2 and SARS-CoV. Science 368, 630–633 (2020).
Huo, J. et al. Neutralization of SARS-CoV-2 by destruction of the prefusion spike. Cell Host Microbe https://doi.org/10.1016/j.chom.2020.06.010 (2020).
Winarski, K. L. et al. Antibody-dependent enhancement of influenza disease promoted by increase in hemagglutinin stem flexibility and virus fusion kinetics. Proc. Natl Acad. Sci. USA 116, 15194–15199 (2019).
Kim, A. S., Leaman, D. P. & Zwick, M. B. Antibody to gp41 MPER alters functional properties of HIV-1 Env without complete neutralization. PLoS Pathog. 10, e1004271 (2014).
Jovčevska, I. & Muyldermans, S. The therapeutic potential of nanobodies. BioDrugs 34, 11–26 (2020).
Chanier, T. & Chames, P. Nanobody engineering: toward next generation immunotherapies and immunoimaging of cancer. Antibodies ( Basel ) 8, 13 (2019).
Peyvandi, F. et al. Caplacizumab reduces the frequency of major thromboembolic events, exacerbations and death in patients with acquired thrombotic thrombocytopenic purpura. J. Thromb. Haemost. 15, 1448–1452 (2017).
Zhou, P. et al. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature 579, 270–273 (2020).
Wrapp, D. et al. Structural basis for potent neutralization of Betacoronaviruses by single-domain camelid antibodies. Cell 181, 1436–1441 (2020).
Walls, A. C. et al. Structure, function and antigenicity of the SARS-CoV-2 spike glycoprotein. Cell 181, 281–292 (2020).
Krissinel, E. & Henrick, K. Detection of protein assemblies in crystals. CompLife 3695, 163–174 (2005).
Gallivan, J. P. & Dougherty, D. A. Cation–π interactions in structural biology. Proc. Natl Acad. Sci. USA 96, 9459–9464 (1999).
Lan, J. et al. Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor. Nature 581, 215–220 (2020).
Shang, J. et al. Structural basis of receptor recognition by SARS-CoV-2. Nature 581, 221–224 (2020).
Song, W., Gui, M., Wang, X. & Xiang, Y. Cryo-EM structure of the SARS coronavirus spike glycoprotein in complex with its host cell receptor ACE2. PLoS Pathog. 14, e1007236 (2018).
Suits, M. D., Sperandeo, P., Dehò, G., Polissi, A. & Jia, Z. Novel structure of the conserved Gram-negative lipopolysaccharide transport protein A and mutagenesis analysis. J. Mol. Biol. 380, 476–488 (2008).
Li, F., Li, W., Farzan, M. & Harrison, S. C. Structure of SARS coronavirus spike receptor-binding domain complexed with receptor. Science 309, 1864–1868 (2005).
Wang, C. et al. A human monoclonal 1 antibody blocking SARS-CoV-2 infection. Nat. Commun. 11, 2251 (2020).
Chi, X. et al. Humanized single domain antibodies neutralize SARS-CoV-2 by targeting spike receptor binding domain. Preprint at bioRxiv https://doi.org/10.1101/2020.04.14.042010 (2020).
Hanke, L. et al. An alpaca nanobody neutralizes SARS-CoV-2 by blocking receptor interaction. Preprint at bioRxiv https://doi.org/10.1101/2020.06.02.130161 (2020).
Mair-Jenkins, J. et al. The effectiveness of convalescent plasma and hyperimmune immunoglobulin for the treatment of severe acute respiratory infections of viral etiology: a systematic review and exploratory meta-analysis. J. Infect. Dis. 211, 80–90 (2015).
Slifka, M. K. & Amanna, I. J. Passive immunization. Plotkin’s Vaccines 8, 84–95 (2018).
Richard, G. et al. In vivo neutralization of α-cobratoxin with high-affinity llama single-domain antibodies (VHHs) and a VHH-Fc antibody. PLoS ONE 8, e69495 (2013).
Klarenbeek, A. et al. Camelid Ig V genes reveal significant human homology not seen in therapeutic target genes, providing for a powerful therapeutic antibody platform. MAbs 7, 693–706 (2015).
Vincke, C. et al. General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold. J. Biol. Chem. 284, 3273–3284 (2009).
Laskowski, R. A. & Swindells, M. B. LigPlot+: multiple ligand–protein interaction diagrams for drug discovery. J. Chem. Inf. Model 51, 2778–2786 (2011).
Caly, L. et al. Isolation and rapid sharing of the 2019 novel coronavirus (SARS-CoV-2) from the first patient diagnosed with COVID-19 in Australia. Med. J. Aust. 212, 459–462 (2020).
Johnson, R. M., Dahlgren, L., Siegfried, B. D. & Ellis, M. D. Acaricide, fungicide and drug interactions in honey bees (Apis mellifera). PLoS ONE 8, e54092 (2013).
de Madrid, A. T. & Porterfield, J. S. A simple micro-culture method for the study of group B arboviruses. Bull. World Health Organ. 40, 113–121 (1969).
Zivanov, J. et al. New tools for automated high-resolution cryo-EM structure determination in RELION-3. Elife 7, e42166 (2018).
Punjani, A., Rubinstein, J. L., Fleet, D. J. & Brubaker, M. A. cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination. Nat. Methods 14, 290–296 (2017).
Asarnow, D., Palovcak, E. & Cheng, Y. UCSF pyem v0.5 (Zenodo, 2019); https://doi.org/10.5281/zenodo.3576630
Pettersen, E. F. et al. UCSF chimera—a visualization system for exploratory research and analysis. J. Comput. Chem. 25, 1605–1612 (2004).
Emsley, P. & Cowtan, K. Coot: model-building tools for molecular graphics. Acta Crystallogr. D Struct. Biol. 60, 2126–2132 (2004).
Liebschner, D. et al. Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix. Acta Crystallogr. D Struct. Biol. 75, 861–877 (2019).
Wagner, T. et al. SPHIRE-crYOLO is a fast and accurate fully automated particle picker for cryo-EM. Commun. Biol. 2, 218 (2019).
Murshudov, G. N. et al. REFMAC5 for the refinement of macromolecular crystal structures. Acta Crystallogr. D Biol. Crystallogr. 67, 355–367 (2011).
Burnley, T., Palmer, C. M. & Winn, M. Recent developments in the CCP-EM software suite. Acta Crystallogr. D Struct. Biol. 73, 469–477 (2017).
Winter, G., Lobley, C. M. & Prince, S. M. Decision making in xia2. Acta Crystallogr. D Biol. Crystallogr. 69, 1260–1273 (2013).
Winter, G. xia2: an expert system for macromolecular crystallography data reduction. J. Appl. Crystallogr. 43, 186–190 (2009).
Schmitz, K. R., Bagchi, A., Roovers, R. C., van Bergen en Henegouwen, P. M. & Ferguson, K. M. Structural evaluation of EGFR inhibition mechanisms for nanobodies/VHH domains. Structure 21, 1214–1224 (2013).
Kovalevskiy, O., Nicholls, R. A., Long, F., Carlon, A. & Murshudov, G. N. Overview of refinement procedures within REFMAC5: utilizing data from different sources. Acta Crystallogr. D Struct. Biol. 74, 215–227 (2018).
Joosten, R. P., Long, F., Murshudov, G. N. & Perrakis, A. The PDB_REDO server for macromolecular structure model optimization. IUCrJ 1, 213–220 (2014).
Davis, I. W. et al. MolProbity: all-atom contacts and structure validation for proteins and nucleic acids. Nucleic Acids Res. 35, W375–W383 (2007).
Painter, J. & Merritt, E. A. TLSMD web server for the generation of multi-group TLS models. J. Appl. Crystallogr. 39, 109–111 (2006).
McCoy, A. J. et al. Phaser crystallographic software. J. Appl. Crystallogr. 40, 658–674 (2007).
Jakobi, A. J., Wilmanns, M. & Sachse, C. Model-based local density sharpening of cryo-EM maps. Elife 6, e27131 (2017).
Acknowledgements
This work was supported by the Rosalind Franklin Institute, funding delivery partner EPSRC. PPUK is funded by the Rosalind Franklin Institute EPSRC grant no. EP/S025243/1. J.H.N., A.L.B., P.J.H., M.W. and P.W. are supported by Wellcome Trust (100209/Z/12/Z). X-ray data were obtained using Diamond Light Source COVID-19 Rapid Access time on Beamline I03 (proposal MX27031). T.M. is supported by Cancer Research UK grants C20724/A14414 and C20724/A26752 (to C. Siebold). J.G.-J. is funded by the National Secretariat of Education (Senescyt–IFTH), Ecuador. H.M.E.D. and J. Ren are supported by the Wellcome Trust (101122/Z/13/Z) and D.I.S. by the UK Medical Research Council (MR/N00065X/1). D.I.S., P.R. and A.R.T. are funded by the Chinese Academy of Medical Sciences (CAMS) Innovation Fund for Medical Science (CIFMS), China (grant no. 2018-I2M-2-002). T.K.T. is funded by the EPA Cephalosporin Fund and The Townsend–Jeantet Charitable Trust (charity no. 1011770). The core virus neutralization facility is supported by gifts to the Oxford COVID-19 Research Response Fund. M.L.K. is supported by the Biotechnology and Biological Sciences Research Council (BBSRC; BB/M011224/1). EM results were obtained at the cryo-EM facility (OPIC) in the Division of Structural Biology, University of Oxford, part of the UK Centre of Instruct-ERIC, and the national EM facility at Diamond, eBIC, through rapid access proposal BI27051. We thank colleagues at the SGC (Oxford) mass spectrometry service for their assistance.
Author information
Authors and Affiliations
Contributions
J.H. identified the parent nanobody and carried out maturation. R.R.R., H.M.E.D., T.M., M.W., D.K.C., V.K.V., J. Radecke, L.C., P.N.M.S. and D.I.S. performed the EM studies. J.H., A.L.B., H.M., J. Ren, D.Z., L.M., Y.Z., D.I.S. and J.H.N. performed crystallography and biophysics. J.H., A.L.B., T.M., T.K.T., R.R., P.J.H., P.N.W., M.D. and P.J.H. produced proteins for the experiments. T.K.T., P.R. and A.R.T. designed the RBD construct for cell surface expression and carried out the cell-based ACE2 competition assays. J.A.T., K.R.B., N.C., M.J.E., M.W.C., J.G.-J., M.L.K. and W.J. carried out neutralization assays. J.H.N. wrote the manuscript with input from all authors. J.H., R.J.O. and J.H.N. designed the study. All authors analyzed the data.
Corresponding authors
Ethics declarations
Competing interests
The Rosalind Franklin Institute has filed a patent on the H11-H4 and H11-D4 nanobodies. J.H., J.H.N., R.J.O. and D.I.S. are named as inventors. The other authors declare no competing interests.
Additional information
Peer review information Peer reviewer reports are available. Inês Chen was the primary editor on this article and managed its editorial process and peer review in collaboration with the rest of the editorial team.
Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
Extended data
Extended Data Fig. 1 Biophysics of the nanobody binding to RBD.
(a) Raw sensorgrams for the H11 parent nanobody. (b) KD of the H11 parent nanobody. (c) H11-H4 binding to RBD-Fc, repeat of Fig. 2b. (d) H11-H4 binding to RBD-Fc. (e) Binding of analytes to ACE2-Fc immobilized on the chip. H11-D4 behaved identically to H11-H4 (Fig. 2c). (f) Binding of analytes to CR2022-Fc immobilized on the chip. H11-D4 behaved identically to H11-H4 (Fig. 2d).
Extended Data Fig. 2 ITC measurements of nanobodies binding to RBD or Spike.
(a) Three independent ITC measurement of H11-H4 and H11-D4 binding to RBD. The errors are s.e.m. for three independent experiments, including the one shown in Fig. 2d. (b) As above, but with the Spike protein.
Extended Data Fig. 3 Neutralization of live virus at Public Health England.
The percentage reduction in plaques arising from virus is plotted againt increasing (left to right) concentration of (a) H11-H4-Fc (6 nM, 95 % CI 3–9 nM) (b) H11-D4-Fc (18 nM, 95 % CI 9–68 nM). The confidence intervals are shown as dashed lines. In Figure 3d,e 5d % infectivity (% infectivity = 100 - % plaque reduction) is plotted against decreasing (left to right) concetration of the agent. (c) The experimental plate with the codes noted below. The plaques caused by the virus are visible.
Extended Data Fig. 4 Neutralization of live virus at Oxford University.
The concentration of neutralizing agent was held constant across a row and decreased on subsequent rows. The agent was tested against high and low virus concentrations. (a) Control plate no agent. (b) CR3022. (c) H11-H4-Fc. (d) H11-H4-Fc varied and CR3022 held constant at 84 nM. Images on left show plaques before pen counting, on the right the pen counts are shown.
Extended Data Fig. 5 Cryo-EM of the H11-H4–Spike complex.
(a) Unbiased 2D class averages of the complex. (b) 2D class averages selected for further processing. (c) FSC resolution criteria. (d) Particle orientation distribution for the final map showed no preferred orientation. (e) Final map colored according to local resolution. (f) Ribbon diagram of the complex and map (gray) contoured at 4 σ Chimera49. (g–i) The three H11-H4 nanobodies with map contoured at 4 σ Chimera49. Maps in f-i used amplitudes scaled based on the refined coordinates using LocScale63.
Extended Data Fig. 6 Cryo-EM of the H11-D4–Spike complex.
(a) Unbiased 2D class averages of the complex. (b) 2D class averages selected for further processing. (c) FSC resolution criteria. (d) Particle orientation distribution for the final map showed no preferred orientation. (e) Final map colored according to local resolution. (f) Ribbon diagram of the complex and map (grey) contoured at 3.8 σ Chimera49. (g–i) The three H11-D4 nanobodies with map contoured at 3.8 σ Chimera49. Maps in f-i used amplitudes scaled based on the refined coordinates using LocScale63.
Extended Data Fig. 7 Further analysis of the cryo-EM nanobody–Spike complexes.
(a) The H11-D4–Spike complex is colored as Fig. 4a. (b) The H11-H4–Spike shown in surface and colored in Fig. 4a, has revealed there is an interaction between H11-H4 bound to a down subunit and the up RBD. (c) A close of up of the interaction shown in Extended Data Fig. 4a. Shown in dark blue is the down RBD from the Spike structure (PDB 6vyb13. The down RBD has shifted by around 2 Å. (d) A model constructed from the closed structure of the Spike bound to H11-H4 revealed no clash, indicating the nanobody will recognize this form too. The model was constructed by superimposing the H11-H4–RBD complex onto the EM structure of the closed form of Spike (PDB 6vxx13).
Extended Data Fig. 8 Further structural analysis of nanobody–RBD crystal structures.
((a) Superimposing the RBDs from the complex with ACE229 (colored bluewhite PDB 6m0j) and the complex with H11-H4, using residues 484 to 510, indicated a hinging movement occurs within the RBD. As a result of this hinge, the Cα of His 519 has shifted 2.1 Å. (b) The binding of H11-H4 results in local shifts at Val483 of the RBD from the ACE2 complex PDB 60J29 (c) 2Fo-Fc electron density map contoured at 2 σ for residues at the H11-H4–RBD interface. (d) 2Fo-Fc electron density map contoured at 2 σ for residues at the H11-D4–RBD interface.
Extended Data Fig. 9 H11-H4 and VHH72 recognize different epitopes.
(a) VHH72 (black) and H11-H4 (yellow) recognize different epitopes on RBD (red). (b) The epitopes for VHH72 and CR3022 (pale pink and lilac) overlap. The figure was generated by superimposing RBD from the CR3002 RBD complex18 (PDB 6YLA), VHH72 SARS-CoV-1 RBD complex25 (PDB 6WAQ) and the H11-H4–RBD complex. (c) Analysis of the crystal packing in the H11-H4–RBD complex revealed that the crystal contact uses the same epitope on the RBD. The crystal contact surface used by H11-H4 is different from that used by VHH72 (the nanobodies are rotated by 180 ° around vertical axis that passes through the center of nanobody). (d) Close up of the crystal contact revealed an antiparallel β-sheet type interaction.
Supplementary information
Supplementary Information
Supplementary Figs. 1 and 2, Supplementary Notes 1 and 2 and Supplementary Table 1.
Rights and permissions
About this article
Cite this article
Huo, J., Le Bas, A., Ruza, R.R. et al. Neutralizing nanobodies bind SARS-CoV-2 spike RBD and block interaction with ACE2. Nat Struct Mol Biol 27, 846–854 (2020). https://doi.org/10.1038/s41594-020-0469-6
Received:
Accepted:
Published:
Issue Date:
DOI: https://doi.org/10.1038/s41594-020-0469-6
This article is cited by
-
A novel human single-domain antibody-drug conjugate targeting CEACAM5 exhibits potent in vitro and in vivo antitumor activity
Acta Pharmacologica Sinica (2024)
-
Automated optimisation of solubility and conformational stability of antibodies and proteins
Nature Communications (2023)
-
The Potential of Nanobodies for COVID-19 Diagnostics and Therapeutics
Molecular Diagnosis & Therapy (2023)
-
Highly potent multivalent VHH antibodies against Chikungunya isolated from an alpaca naïve phage display library
Journal of Nanobiotechnology (2022)
-
A potent synthetic nanobody with broad-spectrum activity neutralizes SARS-CoV-2 virus and the Omicron variant BA.1 through a unique binding mode
Journal of Nanobiotechnology (2022)