Developing an Effective Peptide-Based Vaccine for COVID-19: Preliminary Studies in Mice Models
Abstract
:1. Introduction
2. Materials and Methods
2.1. Antigen and Cell Selection
2.2. SARS-CoV-2 Pseudovirus System Selection
2.3. Mice
2.4. Vaccine Preparation
2.5. Vaccination and Sample Collection
2.6. Indirect ELISA
2.7. T Cell Detection
2.8. Neutralization Assay
2.9. Immunoglobulin Isotyping
2.10. Cytokine Detection with Multiplex Assay
3. Results
3.1. Selection of SARS-CoV-2 Peptides
3.2. Antibody Response Post Vaccination Using Group 1 Peptides with Different Adjuvants
3.3. Antibody Response to Group 2 Peptides with Different Adjuvants
3.4. The Similarity of Epitope Mapping between Recovered Human Sera and Vaccinated Mouse Sera
3.5. The Duration of Antibody Response Post-Vaccination
3.6. Cell Population Analysis to Different Adjuvant Vaccines
3.7. Neutralizing Activity to Pseudovirus System
3.8. The Immunoglobulin Isotyping of Plasma from Vaccinated Mice
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Zieneldien, T.; Kim, J.; Cao, J.; Cao, C. COVID-19 Vaccines: Current Conditions and Future Prospects. Biology 2021, 10, 960. [Google Scholar] [CrossRef] [PubMed]
- Naik, A.Q.; Zafar, T.; Shrivastava, V.K. The Perspective of Coronavirus Disease Outbreak: Epidemiology, Transmission, and Possible Treatment. Vector Borne Zoonotic Dis. 2021, 21, 78–85. [Google Scholar] [CrossRef] [PubMed]
- Kolahchi, Z.; De Domenico, M.; Uddin, L.Q.; Cauda, V.; Grossmann, I.; Lacasa, L.; Grancini, G.; Mahmoudi, M.; Rezaei, N. COVID-19 and Its Global Economic Impact. Adv. Exp. Med. Biol. 2021, 1318, 825–837. [Google Scholar] [CrossRef] [PubMed]
- Cascella, M.; Mauro, I.; De Blasio, E.; Crispo, A.; Del Gaudio, A.; Bimonte, S.; Cuomo, A.; Ascierto, P.A. Rapid and Impressive Response to a Combined Treatment with Single-Dose Tocilizumab and NIV in a Patient with COVID-19 Pneumonia/ARDS. Medicina 2020, 56, 377. [Google Scholar] [CrossRef]
- Mehta, M.; Shyh, G.I. A Review of Remdesivir for COVID-19: Data to Date. Cardiol. Rev. 2020, 28, 332–334. [Google Scholar] [CrossRef]
- Zhang, C.; Huang, S.; Zheng, F.; Dai, Y. Controversial treatments: An updated understanding of the coronavirus disease 2019. J. Med. Virol. 2020, 92, 1441–1448. [Google Scholar] [CrossRef] [Green Version]
- Guo, G.; Ye, L.; Pan, K.; Chen, Y.; Xing, D.; Yan, K.; Chen, Z.; Ding, N.; Li, W.; Huang, H.; et al. New Insights of Emerging SARS-CoV-2: Epidemiology, Etiology, Clinical Features, Clinical Treatment, and Prevention. Front. Cell Dev. Biol. 2020, 8, 410. [Google Scholar] [CrossRef]
- Kreuzberger, N.; Hirsch, C.; Chai, K.L.; Tomlinson, E.; Khosravi, Z.; Popp, M.; Neidhardt, M.; Piechotta, V.; Salomon, S.; Valk, S.J.; et al. SARS-CoV-2-neutralising monoclonal antibodies for treatment of COVID-19. Cochrane Database Syst. Rev. 2021, 9, Cd013825. [Google Scholar] [CrossRef]
- Liu, S.T.H.; Lin, H.M.; Baine, I.; Wajnberg, A.; Gumprecht, J.P.; Rahman, F.; Rodriguez, D.; Tandon, P.; Bassily-Marcus, A.; Bander, J.; et al. Convalescent plasma treatment of severe COVID-19: A propensity score-matched control study. Nat. Med. 2020, 26, 1708–1713. [Google Scholar] [CrossRef]
- Chowdhury, F.R.; Hoque, A.; Chowdhury, F.U.H.; Amin, M.R.; Rahim, A.; Rahman, M.M.; Yasmin, R.; Miah, M.T.; Kalam, M.A.; Rahman, M.S. Convalescent plasma transfusion therapy in severe COVID-19 patients—A safety, efficacy and dose response study: A structured summary of a study protocol of a phase II randomized controlled trial. Trials 2020, 21, 883. [Google Scholar] [CrossRef]
- Lee, W.T.; Girardin, R.C.; Dupuis, A.P.; Kulas, K.E.; Payne, A.F.; Wong, S.J.; Arinsburg, S.; Nguyen, F.T.; Mendu, D.R.; Firpo-Betancourt, A.; et al. Neutralizing Antibody Responses in COVID-19 Convalescent Sera. J. Infect. Dis. 2021, 223, 47–55. [Google Scholar] [CrossRef] [PubMed]
- Maor, Y.; Cohen, D.; Paran, N.; Israely, T.; Ezra, V.; Axelrod, O.; Shinar, E.; Izak, M.; Rahav, G.; Rahimi-Levene, N.; et al. Compassionate use of convalescent plasma for treatment of moderate and severe pneumonia in COVID-19 patients and association with IgG antibody levels in donated plasma. EClinicalMedicine 2020, 26, 100525. [Google Scholar] [CrossRef] [PubMed]
- Duan, K.; Liu, B.; Li, C.; Zhang, H.; Yu, T.; Qu, J.; Zhou, M.; Chen, L.; Meng, S.; Hu, Y.; et al. Effectiveness of convalescent plasma therapy in severe COVID-19 patients. Proc. Natl. Acad. Sci. USA 2020, 117, 9490–9496. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jahanshahlu, L.; Rezaei, N. Monoclonal antibody as a potential anti-COVID-19. Biomed. Pharm. 2020, 129, 110337. [Google Scholar] [CrossRef]
- Hinman, A. Eradication of vaccine-preventable diseases. Annu. Rev. Public Health 1999, 20, 211–229. [Google Scholar] [CrossRef]
- Tamandjou Tchuem, C.R.; Andersson, M.I.; Wiysonge, C.S.; Mufenda, J.; Preiser, W.; Cleary, S. Prevention of hepatitis B mother-to-child transmission in Namibia: A cost-effectiveness analysis. Vaccine 2021, 39, 3141–3151. [Google Scholar] [CrossRef]
- Safadi, R.; Khoury, T.; Saed, N.; Hakim, M.; Jamalia, J.; Nijim, Y.; Farah, N.; Nuser, T.; Natur, N.; Mahamid, M.; et al. Efficacy of Birth Dose Vaccination in Preventing Mother-to-Child Transmission of Hepatitis B: A Randomized Controlled Trial Comparing Engerix-B and Sci-B-Vac. Vaccines 2021, 9, 331. [Google Scholar] [CrossRef]
- Brisson, M.; Kim, J.J.; Canfell, K.; Drolet, M.; Gingras, G.; Burger, E.A.; Martin, D.; Simms, K.T.; Bénard, É.; Boily, M.C.; et al. Impact of HPV vaccination and cervical screening on cervical cancer elimination: A comparative modelling analysis in 78 low-income and lower-middle-income countries. Lancet 2020, 395, 575–590. [Google Scholar] [CrossRef] [Green Version]
- Gottlieb, S.L.; Low, N.; Newman, L.M.; Bolan, G.; Kamb, M.; Broutet, N. Toward global prevention of sexually transmitted infections (STIs): The need for STI vaccines. Vaccine 2014, 32, 1527–1535. [Google Scholar] [CrossRef]
- Amanat, F.; Krammer, F. SARS-CoV-2 Vaccines: Status Report. Immunity 2020, 52, 583–589. [Google Scholar] [CrossRef]
- Chen, W.H.; Strych, U.; Hotez, P.J.; Bottazzi, M.E. The SARS-CoV-2 Vaccine Pipeline: An Overview. Curr. Trop. Med. Rep. 2020, 7, 61–64. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Saif, L.J. Vaccines for COVID-19: Perspectives, Prospects, and Challenges Based on Candidate Sars, Mers, and Animal Coronavirus Vaccines. EMJ 2020, 20032, 1–7. [Google Scholar] [CrossRef] [Green Version]
- Ahmed, S.F.; Quadeer, A.A.; McKay, M.R. Preliminary Identification of Potential Vaccine Targets for the COVID-19 Coronavirus (SARS-CoV-2) Based on SARS-CoV Immunological Studies. Viruses 2020, 12, 254. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yi, C.; Yi, Y.; Li, J. mRNA Vaccines: Possible Tools to Combat SARS-CoV-2. Virol. Sin. 2020, 35, 259–262. [Google Scholar] [CrossRef] [PubMed]
- Voysey, M.; Clemens, S.A.C.; Madhi, S.A.; Weckx, L.Y.; Folegatti, P.M.; Aley, P.K.; Angus, B.; Baillie, V.L.; Barnabas, S.L.; Bhorat, Q.E.; et al. Safety and efficacy of the ChAdOx1 nCoV-19 vaccine (AZD1222) against SARS-CoV-2: An interim analysis of four randomised controlled trials in Brazil, South Africa, and the UK. Lancet 2021, 397, 99–111. [Google Scholar] [CrossRef]
- Knoll, M.D.; Wonodi, C. Oxford-AstraZeneca COVID-19 vaccine efficacy. Lancet 2021, 397, 72–74. [Google Scholar] [CrossRef]
- Jones, I.; Roy, P. Sputnik V COVID-19 vaccine candidate appears safe and effective. Lancet 2021, 397, 642–643. [Google Scholar] [CrossRef]
- Burki, T.K. The Russian vaccine for COVID-19. Lancet Respir. Med. 2020, 8, e85–e86. [Google Scholar] [CrossRef]
- Balakrishnan, V.S. The arrival of Sputnik V. Lancet Infect. Dis. 2020, 20, 1128. [Google Scholar] [CrossRef]
- Johnson, J. A Randomized, Double-Blind, Placebo-Controlled Phase 3 Study to Assess the Efficacy and Safety of Ad26.COV2.S for the Prevention of SARS-CoV-2-Mediated COVID-19 in Adults Aged 18 Years and Older. 2020. Available online: https://www.jnj.com/coronavirus/ensemble-2-study-protocol (accessed on 24 November 2021).
- Keech, C.; Albert, G.; Cho, I.; Robertson, A.; Reed, P.; Neal, S.; Plested, J.; Zhu, M.; Cloney-Clark, S.; Zhou, H.; et al. Phase 1–2 Trial of a SARS-CoV-2 Recombinant Spike Protein Nanoparticle Vaccine. N. Engl. J. Med. 2020, 383, 2320–2332. [Google Scholar] [CrossRef]
- Singh, H.; Jakhar, R.; Sehrawat, N. Designing spike protein (S-Protein) based multi-epitope peptide vaccine against SARS COVID-19 by immunoinformatics. Heliyon 2020, 6, e05558. [Google Scholar] [CrossRef] [PubMed]
- Kyriakidis, N.C.; López-Cortés, A.; González, E.V.; Grimaldos, A.B.; Prado, E.O. SARS-CoV-2 vaccines strategies: A comprehensive review of phase 3 candidates. NPJ Vaccines 2021, 6, 28. [Google Scholar] [CrossRef] [PubMed]
- Li, F. Structure, Function, and Evolution of Coronavirus Spike Proteins. Annu. Rev. Virol. 2016, 3, 237–261. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jackson, C.B.; Farzan, M.; Chen, B.; Choe, H. Mechanisms of SARS-CoV-2 entry into cells. Nat. Rev. Mol. Cell Biol. 2021, 23, 3–20. [Google Scholar] [CrossRef] [PubMed]
- Juraszek, J.; Rutten, L.; Blokland, S.; Bouchier, P.; Voorzaat, R.; Ritschel, T.; Bakkers, M.J.G.; Renault, L.L.R.; Langedijk, J.P.M. Stabilizing the closed SARS-CoV-2 spike trimer. Nat. Commun. 2021, 12, 244. [Google Scholar] [CrossRef] [PubMed]
- Scialo, F.; Daniele, A.; Amato, F.; Pastore, L.; Matera, M.G.; Cazzola, M.; Castaldo, G.; Bianco, A. ACE2: The Major Cell Entry Receptor for SARS-CoV-2. Lung 2020, 198, 867–877. [Google Scholar] [CrossRef] [PubMed]
- Huang, Y.; Yang, C.; Xu, X.F.; Xu, W.; Liu, S.W. Structural and functional properties of SARS-CoV-2 spike protein: Potential antivirus drug development for COVID-19. Acta Pharm. Sin. 2020, 41, 1141–1149. [Google Scholar] [CrossRef]
- Shang, J.; Wan, Y.; Luo, C.; Ye, G.; Geng, Q.; Auerbach, A.; Li, F. Cell entry mechanisms of SARS-CoV-2. Proc. Natl. Acad. Sci. USA 2020, 117, 11727–11734. [Google Scholar] [CrossRef]
- Hamming, I.; Timens, W.; Bulthuis, M.L.; Lely, A.T.; Navis, G.; van Goor, H. Tissue distribution of ACE2 protein, the functional receptor for SARS coronavirus. A first step in understanding SARS pathogenesis. J. Pathol. 2004, 203, 631–637. [Google Scholar] [CrossRef]
- Bourgonje, A.R.; Abdulle, A.E.; Timens, W.; Hillebrands, J.L.; Navis, G.J.; Gordijn, S.J.; Bolling, M.C.; Dijkstra, G.; Voors, A.A.; Osterhaus, A.D.; et al. Angiotensin-converting enzyme 2 (ACE2), SARS-CoV-2 and the pathophysiology of coronavirus disease 2019 (COVID-19). J. Pathol. 2020, 251, 228–248. [Google Scholar] [CrossRef]
- Mahase, E. COVID-19: What have we learnt about the new variant in the UK? BMJ 2020, 371, m4944. [Google Scholar] [CrossRef]
- Nagy, Á.; Pongor, S.; Győrffy, B. Different mutations in SARS-CoV-2 associate with severe and mild outcome. Int. J. Antimicrob. Agents 2021, 57, 106272. [Google Scholar] [CrossRef] [PubMed]
- Iyengar, K.P.; Jain, V.K.; Ish, P. COVID-19 reinfection—An enigmatic public health threat. Monaldi Arch. Chest Dis. 2020, 90. [Google Scholar] [CrossRef] [PubMed]
- Raghav, S.; Ghosh, A.; Turuk, J.; Kumar, S.; Jha, A.; Madhulika, S.; Priyadarshini, M.; Biswas, V.K.; Shyamli, P.S.; Singh, B.; et al. Analysis of Indian SARS-CoV-2 Genomes Reveals Prevalence of D614G Mutation in Spike Protein Predicting an Increase in Interaction with TMPRSS2 and Virus Infectivity. Front. Microbiol. 2020, 11, 594928. [Google Scholar] [CrossRef] [PubMed]
- West, J.; Everden, S.; Nikitas, N. A case of COVID-19 reinfection in the UK. Clin. Med. 2021, 21, e52–e53. [Google Scholar] [CrossRef]
- Iwasaki, A. What reinfections mean for COVID-19. Lancet Infect. Dis. 2021, 21, 3–5. [Google Scholar] [CrossRef]
- Noh, J.Y.; Jeong, H.W.; Shin, E.C. SARS-CoV-2 mutations, vaccines, and immunity: Implication of variants of concern. Signal Transduct. Target. 2021, 6, 203. [Google Scholar] [CrossRef]
- Klinman, D.M.; Klaschik, S.; Tomaru, K.; Shirota, H.; Tross, D.; Ikeuchi, H. Immunostimulatory CpG oligonucleotides: Effect on gene expression and utility as vaccine adjuvants. Vaccine 2010, 28, 1919–1923. [Google Scholar] [CrossRef] [Green Version]
- Garçon, N.; Segal, L.; Tavares, F.; Van Mechelen, M. The safety evaluation of adjuvants during vaccine development: The AS04 experience. Vaccine 2011, 29, 4453–4459. [Google Scholar] [CrossRef]
- Petrovsky, N.; Aguilar, J.C. Vaccine adjuvants: Current state and future trends. Immunol. Cell Biol. 2004, 82, 488–496. [Google Scholar] [CrossRef]
- Orgogozo, J.M.; Gilman, S.; Dartigues, J.F.; Laurent, B.; Puel, M.; Kirby, L.C.; Jouanny, P.; Dubois, B.; Eisner, L.; Flitman, S.; et al. Subacute meningoencephalitis in a subset of patients with AD after Abeta42 immunization. Neurology 2003, 61, 46–54. [Google Scholar] [CrossRef] [PubMed]
- Sasaki, S.; Tsuji, T.; Asakura, Y.; Fukushima, J.; Okuda, K. The search for a potent DNA vaccine against AIDS: The enhancement of immunogenicity by chemical and genetic adjuvants. Anticancer Res. 1998, 18, 3907–3915. [Google Scholar] [PubMed]
- Tan, Z.; Zhou, T.; Zheng, H.; Ding, Y.; Xu, W. Malaria DNA vaccine gp96NTD-CSP elicits both CSP-specific antibody and CD8(+) T cell response. Parasitol. Res. 2015, 114, 2333–2339. [Google Scholar] [CrossRef] [PubMed]
- Cox, K.S.; Clair, J.H.; Prokop, M.T.; Sykes, K.J.; Dubey, S.A.; Shiver, J.W.; Robertson, M.N.; Casimiro, D.R. DNA gag/adenovirus type 5 (Ad5) gag and Ad5 gag/Ad5 gag vaccines induce distinct T-cell response profiles. J. Virol. 2008, 82, 8161–8171. [Google Scholar] [CrossRef] [Green Version]
- Kosinska, A.D.; Johrden, L.; Zhang, E.; Fiedler, M.; Mayer, A.; Wildner, O.; Lu, M.; Roggendorf, M. DNA prime-adenovirus boost immunization induces a vigorous and multifunctional T-cell response against hepadnaviral proteins in the mouse and woodchuck model. J. Virol. 2012, 86, 9297–9310. [Google Scholar] [CrossRef] [Green Version]
- Polack, F.P.; Thomas, S.J.; Kitchin, N.; Absalon, J.; Gurtman, A.; Lockhart, S.; Perez, J.L.; Pérez Marc, G.; Moreira, E.D.; Zerbini, C.; et al. Safety and Efficacy of the BNT162b2 mRNA COVID-19 Vaccine. N. Engl. J. Med. 2020, 383, 2603–2615. [Google Scholar] [CrossRef]
- Larché, M.; Wraith, D.C. Peptide-based therapeutic vaccines for allergic and autoimmune diseases. Nat. Med. 2005, 11, S69–S76. [Google Scholar] [CrossRef]
- Li, W.; Joshi, M.D.; Singhania, S.; Ramsey, K.H.; Murthy, A.K. Peptide Vaccine: Progress and Challenges. Vaccines 2014, 2, 515–536. [Google Scholar] [CrossRef] [Green Version]
- Reche, P.; Flower, D.R.; Fridkis-Hareli, M.; Hoshino, Y. Peptide-Based Immunotherapeutics and Vaccines 2015. J. Immunol. Res. 2015, 2015, 349049. [Google Scholar] [CrossRef]
- Güven, E.; Duus, K.; Laursen, I.; Højrup, P.; Houen, G. Aluminum hydroxide adjuvant differentially activates the three complement pathways with major involvement of the alternative pathway. PLoS ONE 2013, 8, e74445. [Google Scholar] [CrossRef]
- Majgaard Jensen, O.; Koch, C. On the effect of Al(OH)3 as an immunological adjuvant. APMIS 1988, 96, 257–264. [Google Scholar] [CrossRef] [PubMed]
- Lacaille-Dubois, M.A. Updated insights into the mechanism of action and clinical profile of the immunoadjuvant QS-21: A review. Phytomedicine 2019, 60, 152905. [Google Scholar] [CrossRef] [PubMed]
- Livingston, E.H.; Malani, P.N.; Creech, C.B. The Johnson & Johnson Vaccine for COVID-19. JAMA 2021, 325, 1575. [Google Scholar] [CrossRef] [PubMed]
- Sharma, O.; Sultan, A.A.; Ding, H.; Triggle, C.R. A Review of the Progress and Challenges of Developing a Vaccine for COVID-19. Front. Immunol. 2020, 11, 585354. [Google Scholar] [CrossRef]
- Wadman, M.; Cohen, J. Novavax vaccine delivers 89% efficacy against COVID-19 in UK—But is less potent in South Africa. Science 2021, 12, 2774. [Google Scholar]
- Shinde, V.; Bhikha, S.; Hoosain, Z.; Archary, M.; Bhorat, Q.; Fairlie, L.; Lalloo, U.; Masilela, M.S.L.; Moodley, D.; Hanley, S.; et al. Efficacy of NVX-CoV2373 COVID-19 Vaccine against the B.1.351 Variant. N. Engl. J. Med. 2021, 384, 1899–1909. [Google Scholar] [CrossRef]
- Elezkurtaj, S.; Greuel, S.; Ihlow, J.; Michaelis, E.G.; Bischoff, P.; Kunze, C.A.; Sinn, B.V.; Gerhold, M.; Hauptmann, K.; Ingold-Heppner, B.; et al. Causes of death and comorbidities in hospitalized patients with COVID-19. Sci. Rep. 2021, 11, 4263. [Google Scholar] [CrossRef]
- Remmel, A. COVID vaccines and safety: What the research says. Nature 2021, 590, 538–540. [Google Scholar] [CrossRef]
- Chagla, Z. The BNT162b2 (BioNTech/Pfizer) vaccine had 95% efficacy against COVID-19 ≥7 days after the 2nd dose. Ann. Intern. Med. 2021, 174, JC15. [Google Scholar] [CrossRef]
- Hotez, P.J.; Nuzhath, T.; Callaghan, T.; Colwell, B. COVID-19 Vaccine Decisions: Considering the Choices and Opportunities. Microbes Infect. 2021, 23, 104811. [Google Scholar] [CrossRef]
- Mahase, E. COVID-19: Oxford vaccine is up to 90% effective, interim analysis indicates. BMJ 2020, 371, m4564. [Google Scholar] [CrossRef] [PubMed]
- Mahase, E. COVID-19: Russian vaccine efficacy is 91.6%, show phase III trial results. BMJ 2021, 372, n309. [Google Scholar] [CrossRef] [PubMed]
- Callaway, E. Coronavirus vaccines leap through safety trials—But which will work is anybody’s guess. Nature 2020, 583, 669–670. [Google Scholar] [CrossRef]
- Al-Kassmy, J.; Pedersen, J.; Kobinger, G. Vaccine Candidates against Coronavirus Infections. Where Does COVID-19 Stand? Viruses 2020, 12, 861. [Google Scholar] [CrossRef] [PubMed]
- Meo, S.A.; Bukhari, I.A.; Akram, J.; Meo, A.S.; Klonoff, D.C. COVID-19 vaccines: Comparison of biological, pharmacological characteristics and adverse effects of Pfizer/BioNTech and Moderna Vaccines. Eur. Rev. Med. Pharm. Sci. 2021, 25, 1663–1669. [Google Scholar] [CrossRef]
- Reynolds, C.J.; Pade, C.; Gibbons, J.M.; Butler, D.K.; Otter, A.D.; Menacho, K.; Fontana, M.; Smit, A.; Sackville-West, J.E.; Cutino-Moguel, T.; et al. Prior SARS-CoV-2 infection rescues B and T cell responses to variants after first vaccine dose. Science 2021, 372, 1418–1423. [Google Scholar] [CrossRef] [PubMed]
- Sahin, U.; Muik, A.; Derhovanessian, E.; Vogler, I.; Kranz, L.M.; Vormehr, M.; Baum, A.; Pascal, K.; Quandt, J.; Maurus, D.; et al. COVID-19 vaccine BNT162b1 elicits human antibody and TH1T cell responses. Nature 2020, 586, 594–599. [Google Scholar] [CrossRef]
- Koyama, S.; Ishii, K.J.; Coban, C.; Akira, S. Innate immune response to viral infection. Cytokine 2008, 43, 336–341. [Google Scholar] [CrossRef]
- Hojyo, S.; Uchida, M.; Tanaka, K.; Hasebe, R.; Tanaka, Y.; Murakami, M.; Hirano, T. How COVID-19 induces cytokine storm with high mortality. Inflamm. Regen. 2020, 40, 37. [Google Scholar] [CrossRef]
- Baron, S.; Fons, M.; Albrecht, T. Viral Pathogenesis. In Medical Microbiology; Baron, S., Ed.; The University of Texas Medical Branch at Galveston: Galveston, TX, USA, 1996. [Google Scholar]
- Rouse, B.T.; Sehrawat, S. Immunity and immunopathology to viruses: What decides the outcome? Nat. Rev. Immunol. 2010, 10, 514–526. [Google Scholar] [CrossRef]
- Woodham, A.W.; Skeate, J.G.; Sanna, A.M.; Taylor, J.R.; Da Silva, D.M.; Cannon, P.M.; Kast, W.M. Human Immunodeficiency Virus Immune Cell Receptors, Coreceptors, and Cofactors: Implications for Prevention and Treatment. AIDS Patient Care STDS 2016, 30, 291–306. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Shah, V.K.; Firmal, P.; Alam, A.; Ganguly, D.; Chattopadhyay, S. Overview of Immune Response During SARS-CoV-2 Infection: Lessons From the Past. Front. Immunol. 2020, 11, 1949. [Google Scholar] [CrossRef] [PubMed]
- Burgdorf, S.; Kautz, A.; Böhnert, V.; Knolle, P.A.; Kurts, C. Distinct pathways of antigen uptake and intracellular routing in CD4 and CD8 T cell activation. Science 2007, 316, 612–616. [Google Scholar] [CrossRef] [PubMed]
- Ledford, H. How ‘killer’ T cells could boost COVID immunity in face of new variants. Nature 2021, 590, 374–375. [Google Scholar] [CrossRef] [PubMed]
- Sattentau, Q. Correlates of antibody-mediated protection against HIV infection. Curr. Opin. HIV AIDS 2008, 3, 368–374. [Google Scholar] [CrossRef]
- Makhdoomi, M.A.; Khan, L.; Kumar, S.; Aggarwal, H.; Singh, R.; Lodha, R.; Singla, M.; Das, B.K.; Kabra, S.K.; Luthra, K. Evolution of cross-neutralizing antibodies and mapping epitope specificity in plasma of chronic HIV-1-infected antiretroviral therapy-naïve children from India. J. Gen. Virol. 2017, 98, 1879–1891. [Google Scholar] [CrossRef]
Sequence Name | Peptide Sequence | AA Position in S Protein | Vaccine Group |
---|---|---|---|
A1 | CLPFQQFGRDIADTTDAVRDPQTLEIL | 560–585 | Group1 (S1) |
B1 | CYFKIYSKHTPINLVRDLPQ | 200–218 | Group1 (S1) |
C1 | CGVYYHKNNKSWMESEFRVY | 142–160 | Group1 (S1) |
D1 | CFHAIHVSGTNGTKRFDNPVLPF | 65–86 | Group1 (S1) |
E1 | CTRGVYYPDKVFRSSVLHS | 33–50 | Group1 (S1) |
F1 | CYQTQTNSPRRARSVAS | 674–689 | Group1 (S1) |
G1 | CVIAWNSNNLDSKVGGNY | 443–449 | Group1 (S1) |
H1 | CALDPLSETKCTLKSFTVEKGIYQTSNFRV | 291–320 | Group2 (S1) |
I1 | CATVCGPKKSTNLVKNKCVNFNFNG | 522–545 | Group2 (S1) |
J1 | CYNYLYRLFRKSNLKPFERDISTEIYQA | 452–476 | Group2 (S1) |
A2 | CIAVEQDKNTQEVFAQV | 770–783 | Group2 (S2) |
B2 | CKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLL | 786–822 | Group2 (S2) |
C2 | CNSAIGKIQDSLSSTASAL | 927–945 | Group2 (S2) |
D2 | CPLQPELDSFKEELDKYFKNHTSPDVDLGDIS | 1141–1171 | Group2 (S2) |
E2 | CVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWF | 1068–1103 | Group2 (S2) |
F2 | CMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGV | 1236–1267 | Group2 (S2) |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Yang, H.; Cao, J.; Lin, X.; Yue, J.; Zieneldien, T.; Kim, J.; Wang, L.; Fang, J.; Huang, R.-P.; Bai, Y.; et al. Developing an Effective Peptide-Based Vaccine for COVID-19: Preliminary Studies in Mice Models. Viruses 2022, 14, 449. https://doi.org/10.3390/v14030449
Yang H, Cao J, Lin X, Yue J, Zieneldien T, Kim J, Wang L, Fang J, Huang R-P, Bai Y, et al. Developing an Effective Peptide-Based Vaccine for COVID-19: Preliminary Studies in Mice Models. Viruses. 2022; 14(3):449. https://doi.org/10.3390/v14030449
Chicago/Turabian StyleYang, Haiqiang, Jessica Cao, Xiaoyang Lin, Jingwen Yue, Tarek Zieneldien, Janice Kim, Lianchun Wang, Jianmin Fang, Ruo-Pan Huang, Yun Bai, and et al. 2022. "Developing an Effective Peptide-Based Vaccine for COVID-19: Preliminary Studies in Mice Models" Viruses 14, no. 3: 449. https://doi.org/10.3390/v14030449